PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc00696.1.g00050.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MYB
Protein Properties Length: 234aa    MW: 27043.6 Da    PI: 8.1172
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc00696.1.g00050.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding551.9e-171057148
                                    TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
                 Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                                    +g+WT++Ed +lv+ v+++G ++W+ Ia+  g++Rt+k+c++rw +yl
  Zmw_sc00696.1.g00050.1.sm.mkhc 10 KGPWTEQEDTQLVCTVRLFGDRRWDFIAQVSGLNRTGKSCRLRWVNYL 57
                                    79********************************************97 PP

2Myb_DNA-binding55.81e-1764108248
                                     SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
                 Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                                     gr++++E+ l++d+++++G++ W++Iar+++ gRt++++k++w++++
  Zmw_sc00696.1.g00050.1.sm.mkhc  64 GRMSPQEERLIIDLHARWGNR-WSRIARRLP-GRTDNEIKNYWRTHM 108
                                     89*******************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.851557IPR017930Myb domain
SuperFamilySSF466894.49E-298104IPR009057Homeodomain-like
SMARTSM007171.3E-14959IPR001005SANT/Myb domain
PfamPF002493.3E-161057IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-191164IPR009057Homeodomain-like
CDDcd001677.49E-111257No hitNo description
PROSITE profilePS5129425.82658112IPR017930Myb domain
SMARTSM007172.5E-1662110IPR001005SANT/Myb domain
PfamPF002491.3E-1564107IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.6E-2465111IPR009057Homeodomain-like
CDDcd001674.16E-1265108No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 234 aa     Download sequence    Send to blast
MVTVREDTRK GPWTEQEDTQ LVCTVRLFGD RRWDFIAQVS GLNRTGKSCR LRWVNYLHPG  60
LKHGRMSPQE ERLIIDLHAR WGNRWSRIAR RLPGRTDNEI KNYWRTHMRK KAQERNMRMS  120
PSSSSSSLTY QSCFLDATPN AGMISNGARN RSSCITSTLE SIQTAMDGYP MEQIWNEVDA  180
PSMLGIDEPK ENAYGTLPCP LPSAAMLDYK CPEVFWKIED DEIWMSAPQF DYGN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A2e-27101124105MYB PROTO-ONCOGENE PROTEIN
1msf_C2e-27101124105C-Myb DNA-Binding Domain
1mse_C2e-27101124105C-Myb DNA-Binding Domain
1h89_C8e-271011258159MYB PROTO-ONCOGENE PROTEIN
1h88_C8e-271011258159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004980031.11e-131PREDICTED: myb-related protein MYBAS1-like
SwissprotQ53NK61e-120MYBA1_ORYSJ; Myb-related protein MYBAS1
TrEMBLK3ZJP91e-131K3ZJP9_SETIT; Uncharacterized protein
STRINGSi026803m1e-131(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP63637169